Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Aldo-keto reductase family 1 member B1 |
---|
Ligand | BDBM50506667 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1826846 (CHEMBL4326720) |
---|
Ki | 16±n/a nM |
---|
Citation | Maccari, R; Del Corso, A; Paoli, P; Adornato, I; Lori, G; Balestri, F; Cappiello, M; Naß, A; Wolber, G; Ottanà, R An investigation on 4-thiazolidinone derivatives as dual inhibitors of aldose reductase and protein tyrosine phosphatase 1B, in the search for potential agents for the treatment of type 2 diabetes mellitus and its complications. Bioorg Med Chem Lett28:3712-3720 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member B1 |
---|
Name: | Aldo-keto reductase family 1 member B1 |
Synonyms: | AKR1B1 | ALDR1 | ALDR_HUMAN | ALR2 | AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase | Aldose reductase (AR) |
Type: | Protein |
Mol. Mass.: | 35855.50 |
Organism: | Homo sapiens (Human) |
Description: | P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0 |
Residue: | 316 |
Sequence: | MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
|
|
|
BDBM50506667 |
---|
n/a |
---|
Name | BDBM50506667 |
Synonyms: | CHEMBL4448571 |
Type | Small organic molecule |
Emp. Form. | C20H17NO5S |
Mol. Mass. | 383.418 |
SMILES | OC(=O)CN1C(=O)S\C(=C/c2cccc(OCCc3ccccc3)c2)C1=O |
Structure |
|