| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Acyl-protein thioesterase 1 |
|---|
| Ligand | BDBM50508983 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1836616 (CHEMBL4336749) |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Plescia, J; De Cesco, S; Patrascu, MB; Kurian, J; Di Trani, J; Dufresne, C; Wahba, AS; Janmamode, N; Mittermaier, AK; Moitessier, N Integrated Synthetic, Biophysical, and Computational Investigations of Covalent Inhibitors of Prolyl Oligopeptidase and Fibroblast Activation Protein ?. J Med Chem62:7874-7884 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Acyl-protein thioesterase 1 |
|---|
| Name: | Acyl-protein thioesterase 1 |
|---|
| Synonyms: | Acyl-protein thioesterase 1/2 | Apt1 | LYPA1_RAT | Lypla1 | Lysosomal phospholipase A1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 24708.49 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_12731 |
|---|
| Residue: | 230 |
|---|
| Sequence: | MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSSHIKYICPHAPVMP
VTLNMSMMMPSWFDIIGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLM
FGSLTVERLKGLVNPANVTFKVYEGMMHSSCQQEMMDVKYFIDKLLPPID
|
|
|
|---|
| BDBM50508983 |
|---|
| n/a |
|---|
| Name | BDBM50508983 |
|---|
| Synonyms: | CHEMBL4464623 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H22BN3O4 |
|---|
| Mol. Mass. | 319.164 |
|---|
| SMILES | CC(C)[C@H](NC(=O)c1ccncc1)C(=O)N1CCC[C@H]1B(O)O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
