| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50509025 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1837173 (CHEMBL4337306) |
|---|
| Ki | 1696±n/a nM |
|---|
| Citation |  Cheng, HWA; Sokias, R; Werry, EL; Ittner, LM; Reekie, TA; Du, J; Gao, Q; Hibbs, DE; Kassiou, M First Nondiscriminating Translocator Protein Ligands Produced from a Carbazole Scaffold. J Med Chem62:8235-8248 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50509025 |
|---|
| n/a |
|---|
| Name | BDBM50509025 |
|---|
| Synonyms: | CHEMBL4536533 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H25ClN2O2 |
|---|
| Mol. Mass. | 468.974 |
|---|
| SMILES | COc1cccc(CN(C)C(=O)Cn2c3ccccc3c3cc(ccc23)-c2ccc(Cl)cc2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
