Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Methylated-DNA--protein-cysteine methyltransferase |
---|
Ligand | BDBM50062813 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_144844 (CHEMBL752890) |
---|
IC50 | 1300±n/a nM |
---|
Citation | Terashima, I; Kohda, K Inhibition of human O6-alkylguanine-DNA alkyltransferase and potentiation of the cytotoxicity of chloroethylnitrosourea by 4(6)-(benzyloxy)-2,6(4)-diamino-5-(nitro or nitroso)pyrimidine derivatives and analogues. J Med Chem41:503-8 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Methylated-DNA--protein-cysteine methyltransferase |
---|
Name: | Methylated-DNA--protein-cysteine methyltransferase |
Synonyms: | 6-O-methylguanine-DNA methyltransferase | MGMT | MGMT_HUMAN |
Type: | PROTEIN |
Mol. Mass.: | 21651.27 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_144711 |
Residue: | 207 |
Sequence: | MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLM
QCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAAL
AGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG
LGGSSGLAGAWLKGAGATSGSPPAGRN
|
|
|
BDBM50062813 |
---|
n/a |
---|
Name | BDBM50062813 |
Synonyms: | 6-Benzyloxy-5-nitro-pyrimidine-2,4-diamine | CHEMBL121479 |
Type | Small organic molecule |
Emp. Form. | C11H11N5O3 |
Mol. Mass. | 261.2367 |
SMILES | Nc1nc(N)c(c(OCc2ccccc2)n1)[N+]([O-])=O |
Structure |
|