| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Methylated-DNA--protein-cysteine methyltransferase |
|---|
| Ligand | BDBM50062819 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_144844 (CHEMBL752890) |
|---|
| IC50 | 1600±n/a nM |
|---|
| Citation |  Terashima, I; Kohda, K Inhibition of human O6-alkylguanine-DNA alkyltransferase and potentiation of the cytotoxicity of chloroethylnitrosourea by 4(6)-(benzyloxy)-2,6(4)-diamino-5-(nitro or nitroso)pyrimidine derivatives and analogues. J Med Chem41:503-8 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Methylated-DNA--protein-cysteine methyltransferase |
|---|
| Name: | Methylated-DNA--protein-cysteine methyltransferase |
|---|
| Synonyms: | 6-O-methylguanine-DNA methyltransferase | MGMT | MGMT_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 21651.27 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_144711 |
|---|
| Residue: | 207 |
|---|
| Sequence: | MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLM
QCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAAL
AGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG
LGGSSGLAGAWLKGAGATSGSPPAGRN
|
|
|
|---|
| BDBM50062819 |
|---|
| n/a |
|---|
| Name | BDBM50062819 |
|---|
| Synonyms: | 5-Nitro-6-(pyridin-3-ylmethoxy)-pyrimidine-2,4-diamine | CHEMBL359048 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H10N6O3 |
|---|
| Mol. Mass. | 262.2248 |
|---|
| SMILES | Nc1nc(N)c(c(OCc2cccnc2)n1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
