| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50509288 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1837839 (CHEMBL4337972) |
|---|
| IC50 | >50000±n/a nM |
|---|
| Citation |  Medina-O'Donnell, M; Rivas, F; Reyes-Zurita, FJ; Cano-Muņoz, M; Martinez, A; Lupiaņez, JA; Parra, A Oleanolic Acid Derivatives as Potential Inhibitors of HIV-1 Protease. J Nat Prod82:2886-2896 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50509288 |
|---|
| n/a |
|---|
| Name | BDBM50509288 |
|---|
| Synonyms: | CHEMBL4586500 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C48H81NO5 |
|---|
| Mol. Mass. | 752.1604 |
|---|
| SMILES | [H][C@@]12CC(C)(C)CC[C@@]1(CC[C@]1(C)C2=CC[C@]2([H])[C@@]3(C)CC[C@H](OC(=O)CCCCCCCCCCC)C(C)(C)[C@]3([H])CC[C@@]12C)C(=O)NCCCCCC(O)=O |r,t:15| |
|---|
| Structure | 
|
|---|
Search and Browse
