| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50064044 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_55239 (CHEMBL666993) |
|---|
| IC50 | 970±n/a nM |
|---|
| Citation |  Gangjee, A; Elzein, E; Queener, SF; McGuire, JJ Synthesis and biological activities of tricyclic conformationally restricted tetrahydropyrido annulated furo[2,3-d]pyrimidines as inhibitors of dihydrofolate reductases. J Med Chem41:1409-16 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate reductase (DHFR) | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 19884.75 |
|---|
| Organism: | Mycobacterium avium |
|---|
| Description: | Recombinant Mycobacterium avium DHFR expressed in E. coli. |
|---|
| Residue: | 181 |
|---|
| Sequence: | MTRAEVGLVWAQSTSGVIGRGGDIPWSVPEDLTRFKEVTMGHTVIMGRRTWESLPAKVRP
LPGRRNVVVSRRPDFVAEGARVAGSLEAALAYAGSDPAPWVIGGAQIYLLALPHATRCEV
TEIEIDLRRDDDDALAPALDDSWVGETGEWLASRSGLRYRFHSYRRDPRSSVRGCSPSRP
S
|
|
|
|---|
| BDBM50064044 |
|---|
| n/a |
|---|
| Name | BDBM50064044 |
|---|
| Synonyms: | (S)-2-[4-(2,4-Diamino-5,8-dihydro-6H-pyrido[4',3':4,5]furo[2,3-d]pyrimidin-7-ylmethyl)-benzoylamino]-pentanedioic acid | CHEMBL418214 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H24N6O6 |
|---|
| Mol. Mass. | 468.4626 |
|---|
| SMILES | Nc1nc(N)c2c3CCN(Cc4ccc(cc4)C(=O)N[C@@H](CCC(O)=O)C(O)=O)Cc3oc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
