Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM50064364 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_66271 (CHEMBL678141) |
---|
IC50 | 71±n/a nM |
---|
Citation | Wagner, R; Rhoades, TA; Or, YS; Lane, BC; Hsieh, G; Mollison, KW; Luly, JR 32-Ascomycinyloxyacetic acid derived immunosuppressants. Independence of immunophilin binding and immunosuppressive potency. J Med Chem41:1764-76 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM50064364 |
---|
n/a |
---|
Name | BDBM50064364 |
Synonyms: | 2-{4-[2-(17-Ethyl-1,14-dihydroxy-23,25-dimethoxy-13,19,21,27-tetramethyl-2,3,10,16-tetraoxo-11,28-dioxa-4-aza-tricyclo[22.3.1.0*4,9*]octacos-18-en-12-yl)-propenyl]-2-methoxy-cyclohexyloxy}-N-p-tolyl-acetamide | CHEMBL295945 |
Type | Small organic molecule |
Emp. Form. | C52H78N2O13 |
Mol. Mass. | 939.1813 |
SMILES | CC[C@@H]1\C=C(C)\C[C@H](C)C[C@H](OC)[C@H]2O[C@](O)([C@H](C)C[C@@H]2OC)C(=O)C(=O)N2CCCC[C@H]2C(=O)O[C@@H]([C@H](C)[C@@H](O)CC1=O)C(\C)=C\C1CC[C@@H](OCC(=O)Nc2ccc(C)cc2)[C@@H](C1)OC |c:3| |
Structure |
|