| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-related protein A1 |
|---|
| Ligand | BDBM50511134 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1843887 (CHEMBL4344314) |
|---|
| Ki | 810±n/a nM |
|---|
| Citation |  Kump, KJ; Miao, L; Mady, ASA; Ansari, NH; Shrestha, UK; Yang, Y; Pal, M; Liao, C; Perdih, A; Abulwerdi, FA; Chinnaswamy, K; Meagher, JL; Carlson, JM; Khanna, M; Stuckey, JA; Nikolovska-Coleska, Z Discovery and Characterization of 2,5-Substituted Benzoic Acid Dual Inhibitors of the Anti-apoptotic Mcl-1 and Bfl-1 Proteins. J Med Chem63:2489-2510 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl-2-related protein A1 |
|---|
| Name: | Bcl-2-related protein A1 |
|---|
| Synonyms: | B2LA1_HUMAN | BCL2A1 | BCL2L5 | BFL1 | Bcl-2-like protein 5 | GRS | HBPA1 | Hemopoietic-specific early response protein | Protein BFL-1 | Protein GRS |
|---|
| Type: | Apoptosis regulator protein |
|---|
| Mol. Mass.: | 20130.01 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 175 |
|---|
| Sequence: | MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
|
|
|
|---|
| BDBM50511134 |
|---|
| n/a |
|---|
| Name | BDBM50511134 |
|---|
| Synonyms: | CHEMBL4435041 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H18BrNO4S2 |
|---|
| Mol. Mass. | 492.406 |
|---|
| SMILES | OC(=O)c1cc(SCCc2ccccc2)ccc1NS(=O)(=O)c1ccc(Br)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
