Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50514234 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1855924 (CHEMBL4356653) |
---|
Ki | 6.0±n/a nM |
---|
Citation | García, M; Virgili, M; Alonso, M; Alegret, C; Fernández, B; Port, A; Pascual, R; Monroy, X; Vidal-Torres, A; Serafini, MT; Vela, JM; Almansa, C 4-Aryl-1-oxa-4,9-diazaspiro[5.5]undecane Derivatives as Dual ?-Opioid Receptor Agonists and ? J Med Chem63:2434-2454 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50514234 |
---|
n/a |
---|
Name | BDBM50514234 |
Synonyms: | CHEMBL4541206 |
Type | Small organic molecule |
Emp. Form. | C23H28N2O2 |
Mol. Mass. | 364.4806 |
SMILES | CC1OC2(CCN(CCc3ccccc3)CC2)CN(C1=O)c1ccccc1 |
Structure |
|