Reaction Details |
| Report a problem with these data |
Target | Hypoxanthine-guanine phosphoribosyltransferase |
---|
Ligand | BDBM50467710 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1875733 (CHEMBL4377127) |
---|
Ki | 3.0±n/a nM |
---|
Citation | Cheviet, T; Lefebvre-Tournier, I; Wein, S; Peyrottes, S Plasmodium Purine Metabolism and Its Inhibition by Nucleoside and Nucleotide Analogues. J Med Chem62:8365-8391 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hypoxanthine-guanine phosphoribosyltransferase |
---|
Name: | Hypoxanthine-guanine phosphoribosyltransferase |
Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
Type: | Protein |
Mol. Mass.: | 24579.61 |
Organism: | Homo sapiens (Human) |
Description: | P00492 |
Residue: | 218 |
Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
BDBM50467710 |
---|
n/a |
---|
Name | BDBM50467710 |
Synonyms: | CHEMBL4290716 |
Type | Small organic molecule |
Emp. Form. | C14H22N6O10P2 |
Mol. Mass. | 496.3062 |
SMILES | Nc1nc2n(cnc2c(=O)[nH]1)[C@@H]1CN(C[C@H]1OC[C@@H](O)P(O)(O)=O)C(=O)CCP(O)(O)=O |r| |
Structure |
|