Reaction Details |
| Report a problem with these data |
Target | N-formyl peptide receptor 2 |
---|
Ligand | BDBM50520823 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1882215 (CHEMBL4383714) |
---|
IC50 | 31±n/a nM |
---|
Citation | de Gaetano, M; Butler, E; Gahan, K; Zanetti, A; Marai, M; Chen, J; Cacace, A; Hams, E; Maingot, C; McLoughlin, A; Brennan, E; Leroy, X; Loscher, CE; Fallon, P; Perretti, M; Godson, C; Guiry, PJ Asymmetric synthesis and biological evaluation of imidazole- and oxazole-containing synthetic lipoxin A Eur J Med Chem162:80-108 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
N-formyl peptide receptor 2 |
---|
Name: | N-formyl peptide receptor 2 |
Synonyms: | ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | FPR2 | FPR2_HUMAN | FPRH1 | FPRL1 | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | LXA4R | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38968.35 |
Organism: | Homo sapiens (Human) |
Description: | P25090 |
Residue: | 351 |
Sequence: | METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
|
|
|
BDBM50520823 |
---|
n/a |
---|
Name | BDBM50520823 |
Synonyms: | CHEMBL4434857 |
Type | Small organic molecule |
Emp. Form. | C26H37NO6 |
Mol. Mass. | 459.5751 |
SMILES | CCCCC[C@H](O)c1nc(oc1\C=C\[C@@H](O)[C@@H](O)CCCC(=O)OC(C)C)-c1ccccc1 |r| |
Structure |
|