| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50522186 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1886095 (CHEMBL4387677) |
|---|
| Ki | 31±n/a nM |
|---|
| Citation |  Ghosh, AK; Williams, JN; Kovela, S; Takayama, J; Simpson, HM; Walters, DE; Hattori, SI; Aoki, M; Mitsuya, H Potent HIV-1 protease inhibitors incorporating squaramide-derived P2 ligands: Design, synthesis, and biological evaluation. Bioorg Med Chem Lett29:2565-2570 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50522186 |
|---|
| n/a |
|---|
| Name | BDBM50522186 |
|---|
| Synonyms: | CHEMBL4445644 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H36N2O8S |
|---|
| Mol. Mass. | 572.67 |
|---|
| SMILES | COc1ccc(cc1)S(=O)(=O)N(CC(C)C)C[C@@H](O)[C@H](Cc1ccccc1)Nc1c(O[C@H]2CCOC2)c(=O)c1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
