Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Aldo-keto reductase family 1 member B1 |
---|
Ligand | BDBM50522312 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1886422 (CHEMBL4388099) |
---|
IC50 | 15790±n/a nM |
---|
Citation | Iqbal, Z; Morahan, G; Arooj, M; Sobolev, AN; Hameed, S Synthesis of new arylsulfonylspiroimidazolidine-2',4'-diones and study of their effect on stimulation of insulin release from MIN6 cell line, inhibition of human aldose reductase, sorbitol accumulations in various tissues and oxidative stress. Eur J Med Chem168:154-175 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member B1 |
---|
Name: | Aldo-keto reductase family 1 member B1 |
Synonyms: | ALDR_RAT | Akr1b1 | Akr1b4 | Aldose reductase | Aldr1 |
Type: | PROTEIN |
Mol. Mass.: | 35797.87 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_1512484 |
Residue: | 316 |
Sequence: | MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQ
EKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGP
DYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKP
AVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAK
YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCA
LMSCAKHKDYPFHAEV
|
|
|
BDBM50522312 |
---|
n/a |
---|
Name | BDBM50522312 |
Synonyms: | CHEMBL4560452 |
Type | Small organic molecule |
Emp. Form. | C19H18N2O5S |
Mol. Mass. | 386.422 |
SMILES | COc1ccc(cc1)S(=O)(=O)N1C(=O)NC2(CCCc3ccccc23)C1=O |
Structure |
|