| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member B1 |
|---|
| Ligand | BDBM50522309 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1886412 (CHEMBL4388089) |
|---|
| IC50 | 1700±n/a nM |
|---|
| Citation |  Iqbal, Z; Morahan, G; Arooj, M; Sobolev, AN; Hameed, S Synthesis of new arylsulfonylspiroimidazolidine-2',4'-diones and study of their effect on stimulation of insulin release from MIN6 cell line, inhibition of human aldose reductase, sorbitol accumulations in various tissues and oxidative stress. Eur J Med Chem168:154-175 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member B1 |
|---|
| Name: | Aldo-keto reductase family 1 member B1 |
|---|
| Synonyms: | ALDR_RAT | Akr1b1 | Akr1b4 | Aldose reductase | Aldr1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 35797.87 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_1512484 |
|---|
| Residue: | 316 |
|---|
| Sequence: | MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQ
EKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGP
DYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKP
AVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAK
YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCA
LMSCAKHKDYPFHAEV
|
|
|
|---|
| BDBM50522309 |
|---|
| n/a |
|---|
| Name | BDBM50522309 |
|---|
| Synonyms: | CHEMBL4532536 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H18N2O4S |
|---|
| Mol. Mass. | 370.422 |
|---|
| SMILES | Cc1ccc(cc1)S(=O)(=O)N1C(=O)NC2(CCCc3ccccc23)C1=O |
|---|
| Structure | 
|
|---|
Search and Browse
