| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50524439 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1893316 (CHEMBL4395237) |
|---|
| Ki | 652±n/a nM |
|---|
| Citation |  Romeo, G; Prezzavento, O; Intagliata, S; Pittalà, V; Modica, MN; Marrazzo, A; Turnaturi, R; Parenti, C; Chiechio, S; Arena, E; Campisi, A; Sposito, G; Salerno, L Synthesis, in vitro and in vivo characterization of new benzoxazole and benzothiazole-based sigma receptor ligands. Eur J Med Chem174:226-235 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | MAC30 | Meningioma-associated protein 30 | S2R | SGMR2_HUMAN | Sigma-2 receptor | Sigma2 receptor | TMEM97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20857.20 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q5BJF2 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
|
|
|
|---|
| BDBM50524439 |
|---|
| n/a |
|---|
| Name | BDBM50524439 |
|---|
| Synonyms: | CHEMBL4553933 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H19ClN2O2 |
|---|
| Mol. Mass. | 294.777 |
|---|
| SMILES | Clc1ccc2oc(=O)n(CCN3CCCCCC3)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
