| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-8 |
|---|
| Ligand | BDBM50526818 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1901164 (CHEMBL4403386) |
|---|
| IC50 | 15±n/a nM |
|---|
| Citation |  Xi, J; Zhuang, R; Kong, L; He, R; Zhu, H; Zhang, J Immunoproteasome-selective inhibitors: An overview of recent developments as potential drugs for hematologic malignancies and autoimmune diseases. Eur J Med Chem182:0 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-8 |
|---|
| Name: | Proteasome subunit beta type-8 |
|---|
| Synonyms: | 26S proteosome | LMP7 | Low molecular mass protein 7 | Macropain subunit C13 | Multicatalytic endopeptidase complex subunit C13 | PSB8_HUMAN | PSMB5i | PSMB8 | Proteasome component C13 | Proteasome subunit beta type-8 | Proteasome subunit beta-5i | RING10 | Y2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30357.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1446797 |
|---|
| Residue: | 276 |
|---|
| Sequence: | MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGD
GERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKG
PGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDS
YSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
|
|
|
|---|
| BDBM50526818 |
|---|
| n/a |
|---|
| Name | BDBM50526818 |
|---|
| Synonyms: | CHEMBL4592435 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H32F2N4O5S |
|---|
| Mol. Mass. | 550.618 |
|---|
| SMILES | CC(C)(C)NC(=O)C[C@H](NS(=O)(=O)C1CC1)C(=O)NCCNC(=O)c1cc(ccc1F)-c1ccccc1F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
