| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 3 |
|---|
| Ligand | BDBM50527464 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1902655 (CHEMBL4404877) |
|---|
| EC50 | 1318±n/a nM |
|---|
| Citation |  Ulven, ER; Quon, T; Sergeev, E; Barki, N; Brvar, M; Hudson, BD; Dutta, P; Hansen, AH; Bielefeldt, LŲ; Tobin, AB; McKenzie, CJ; Milligan, G; Ulven, T Structure-Activity Relationship Studies of Tetrahydroquinolone Free Fatty Acid Receptor 3 Modulators. J Med Chem63:3577-3595 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 3 |
|---|
| Name: | Free fatty acid receptor 3 |
|---|
| Synonyms: | FFAR3_MOUSE | Ffar3 | Free fatty acid receptor 3 | G-protein coupled receptor 41 | Gm478 | Gm478 | Gpr41 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 36514.65 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_109430 |
|---|
| Residue: | 319 |
|---|
| Sequence: | MGTSFFLGNYWLFFSVYLLVFLVGLPLNVMALVVFVGKLRRRPVAVDLLLLNLTISDLLL
LLFLPFRMVEAACGMRWLLPFIFCPLSGFLFFTTIYLTSLFLTAVSIERFLSVAYPLWYK
TRPRLAQAGLVSVVCWFLASAHCSVVYITEYWGNATYSQGTNGTCYLEFREDQLAILLPV
RLEMAVVLFMVPLCITSYCYSRLVWILSRGASRRRRKRIMGLLAATLLIFFVCFGPYNMS
HVVGYVSRESPSWRSYVLLLSTLNSCIDPLVFYFSSSKFQADFHQLLGRLLRTCVPWTQQ
VSLELKVKNGEEPSKECPS
|
|
|
|---|
| BDBM50527464 |
|---|
| n/a |
|---|
| Name | BDBM50527464 |
|---|
| Synonyms: | CHEMBL4564389 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H18Cl2N2O3 |
|---|
| Mol. Mass. | 417.285 |
|---|
| SMILES | CC1=C(C(c2ccco2)C2=C(CCCC2=O)N1)C(=O)Nc1cc(Cl)ccc1Cl |t:1,10| |
|---|
| Structure | 
|
|---|
Search and Browse
