| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50527843 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1903818 (CHEMBL4406040) |
|---|
| Ki | 50±n/a nM |
|---|
| Citation |  Tosh, DK; Salmaso, V; Rao, H; Bitant, A; Fisher, CL; Lieberman, DI; Vorbrüggen, H; Reitman, ML; Gavrilova, O; Gao, ZG; Auchampach, JA; Jacobson, KA Truncated (N)-Methanocarba Nucleosides as Partial Agonists at Mouse and Human A J Med Chem63:4334-4348 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50527843 |
|---|
| n/a |
|---|
| Name | BDBM50527843 |
|---|
| Synonyms: | CHEMBL4537118 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H21Cl2N5O2S |
|---|
| Mol. Mass. | 526.438 |
|---|
| SMILES | [H][C@@]12C[C@]1([H])[C@H]([C@H](O)[C@@H]2O)n1cnc2c(NCCc3cccc(Cl)c3)nc(nc12)C#Cc1ccc(Cl)s1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
