| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50274561 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1912567 (CHEMBL4415150) |
|---|
| Ki | 0.860000±n/a nM |
|---|
| Citation |  Vanda, D; Zajdel, P; Soural, M Imidazopyridine-based selective and multifunctional ligands of biological targets associated with psychiatric and neurodegenerative diseases. Eur J Med Chem181:0 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50274561 |
|---|
| n/a |
|---|
| Name | BDBM50274561 |
|---|
| Synonyms: | 4-(2-(4-Chlorophenyl)-3-(2-(dipropylamino)-2-oxoethyl)imidazo[1,2-a]pyridin-8-ylamino)-4-oxobutanoate | CHEMBL483596 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H33ClN4O4 |
|---|
| Mol. Mass. | 513.028 |
|---|
| SMILES | CCCN(CCC)C(=O)Cc1c(nc2c(NC(=O)CCC(=O)OCC)cccn12)-c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
