| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-2 |
|---|
| Ligand | BDBM11318 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1930125 (CHEMBL4433376) |
|---|
| IC50 | 20850±n/a nM |
|---|
| Citation |  Golonko, A; Pienkowski, T; Swislocka, R; Lazny, R; Roszko, M; Lewandowski, W Another look at phenolic compounds in cancer therapy the effect of polyphenols on ubiquitin-proteasome system. Eur J Med Chem167:291-311 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-2 |
|---|
| Name: | Proteasome subunit beta type-2 |
|---|
| Synonyms: | 20S proteasome | PSB2_HUMAN | PSMB2 | Proteasome Macropain subunit |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22837.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1294233 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
|
|
|
|---|
| BDBM11318 |
|---|
| n/a |
|---|
| Name | BDBM11318 |
|---|
| Synonyms: | 1,3,8-trihydroxy-6-methyl-9,10-dihydroanthracene-9,10-dione | 1,3,8-trihydroxy-6-methylanthra-9,10-quinone | CHEMBL289277 | Emodin | US20230364057, Compound 242 | med.21724, Compound 24 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H10O5 |
|---|
| Mol. Mass. | 270.2369 |
|---|
| SMILES | Cc1cc(O)c2C(=O)c3c(O)cc(O)cc3C(=O)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
