| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-5 |
|---|
| Ligand | BDBM19459 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1930137 (CHEMBL4433388) |
|---|
| IC50 | 65000±n/a nM |
|---|
| Citation |  Golonko, A; Pienkowski, T; Swislocka, R; Lazny, R; Roszko, M; Lewandowski, W Another look at phenolic compounds in cancer therapy the effect of polyphenols on ubiquitin-proteasome system. Eur J Med Chem167:291-311 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-5 |
|---|
| Name: | Proteasome subunit beta type-5 |
|---|
| Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28480.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 263 |
|---|
| Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
|---|
| BDBM19459 |
|---|
| n/a |
|---|
| Name | BDBM19459 |
|---|
| Synonyms: | 5,7-dihydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-one | CHEMBL44 | Genistein | Genistein, 8 | Genisteol | Prunetol | US8552057, 2 | cid_5280961 |
|---|
| Type | Phytoestrogen |
|---|
| Emp. Form. | C15H10O5 |
|---|
| Mol. Mass. | 270.2369 |
|---|
| SMILES | Oc1ccc(cc1)-c1coc2cc(O)cc(O)c2c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
