| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Heme oxygenase 1 |
|---|
| Ligand | BDBM50315702 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1930144 (CHEMBL4433395) |
|---|
| IC50 | 270±n/a nM |
|---|
| Citation |  Salerno, L; Floresta, G; Ciaffaglione, V; Gentile, D; Margani, F; Turnaturi, R; Rescifina, A; Pittalą, V Progress in the development of selective heme oxygenase-1 inhibitors and their potential therapeutic application. Eur J Med Chem167:439-453 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Heme oxygenase 1 |
|---|
| Name: | Heme oxygenase 1 |
|---|
| Synonyms: | HMOX1_RAT | HSP32 | Heme Oxygenase 1 (HO-1) | Heme oxygenase 1 | Hmox1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 33005.15 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | HO-1 obtained from rat spleen was used in enzyme assays. |
|---|
| Residue: | 289 |
|---|
| Sequence: | MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHE
VGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRP
ASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
|
|
|
|---|
| BDBM50315702 |
|---|
| n/a |
|---|
| Name | BDBM50315702 |
|---|
| Synonyms: | CHEMBL4166126 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H18N2O |
|---|
| Mol. Mass. | 290.359 |
|---|
| SMILES | O=C(CC(c1ccccc1)c1ccccc1)Cn1ccnc1 |
|---|
| Structure | 
|
|---|
Search and Browse
