| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Vitamin K epoxide reductase complex subunit 1 |
|---|
| Ligand | BDBM50535484 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1930830 (CHEMBL4434081) |
|---|
| IC50 | 59±n/a nM |
|---|
| Citation |  Xing, H; Houston, SD; Chen, X; Jin, DY; Savage, GP; Tie, JK; Williams, CM Determining the necessity of phenyl ring ?-character in warfarin. Bioorg Med Chem Lett29:1954-1956 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Vitamin K epoxide reductase complex subunit 1 |
|---|
| Name: | Vitamin K epoxide reductase complex subunit 1 |
|---|
| Synonyms: | VKOR | VKOR1_HUMAN | VKORC1 | Vitamin K epoxide reductase complex subunit 1 | Vitamin K epoxide reductase complex subunit 1 (hVKORC1) | Vitamin K1 2,3-epoxide reductase subunit 1 | Vitamin k epoxide reductase complex subunit 1 isoform 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18244.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9BQB6 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWG
RGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYL
AWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH
|
|
|
|---|
| BDBM50535484 |
|---|
| n/a |
|---|
| Name | BDBM50535484 |
|---|
| Synonyms: | CHEMBL4517532 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H26O4 |
|---|
| Mol. Mass. | 342.4287 |
|---|
| SMILES | CC(=O)CC(C1CCCCCCC1)c1c(O)c2ccccc2oc1=O |
|---|
| Structure | 
|
|---|
Search and Browse
