| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Ligand | BDBM50049730 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1936197 (CHEMBL4481956) |
|---|
| IC50 | >200000±n/a nM |
|---|
| Citation |  Xu, JF; Wang, TT; Yuan, Q; Duan, YT; Xu, YJ; Lv, PC; Wang, XM; Yang, YS; Zhu, HL Discovery and development of novel rhodanine derivatives targeting enoyl-acyl carrier protein reductase. Bioorg Med Chem27:1509-1516 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Synonyms: | Enoyl-ACP Reductase (InhA) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-[acyl-carrier-protein] reductase [NADH] | INHA_MYCTU | NADH-dependent enoyl-ACP reductase | inhA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28526.00 |
|---|
| Organism: | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
|---|
| Description: | P9WGR1 |
|---|
| Residue: | 269 |
|---|
| Sequence: | MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPL
LELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGI
HISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG
KYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAK
TVCALLSDWLPATTGDIIYADGGAHTQLL
|
|
|
|---|
| BDBM50049730 |
|---|
| n/a |
|---|
| Name | BDBM50049730 |
|---|
| Synonyms: | 2-(5-(2-methyl-3-phenylallylidene)-4-oxo-2-thioxothiazolidin-3-yl)acetic acid | CHEMBL56337 | Epalrestat | {5-[(E)-2-Methyl-3-phenyl-prop-2-en-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-acetic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H13NO3S2 |
|---|
| Mol. Mass. | 319.399 |
|---|
| SMILES | C\C(\C=C1/SC(=S)N(CC(O)=O)C1=O)=C/c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
