Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Fatty acid-binding protein, heart |
---|
Ligand | BDBM50538234 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1972440 (CHEMBL4605258) |
---|
Ki | 860±n/a nM |
---|
Citation | Su, H; Zou, Y; Chen, G; Dou, H; Xie, H; Yuan, X; Zhang, X; Zhang, N; Li, M; Xu, Y Exploration of Fragment Binding Poses Leading to Efficient Discovery of Highly Potent and Orally Effective Inhibitors of FABP4 for Anti-inflammation. J Med Chem63:4090-4106 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein, heart |
---|
Name: | Fatty acid-binding protein, heart |
Synonyms: | FABP11 | FABP3 | FABPH_HUMAN | Fatty acid binding protein muscle | MDGI |
Type: | PROTEIN |
Mol. Mass.: | 14858.36 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1463784 |
Residue: | 133 |
Sequence: | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
|
|
|
BDBM50538234 |
---|
n/a |
---|
Name | BDBM50538234 |
Synonyms: | CHEMBL4644705 |
Type | Small organic molecule |
Emp. Form. | C20H14ClNO4 |
Mol. Mass. | 367.782 |
SMILES | OC(=O)c1ccccc1Nc1cccc(Cl)c1-c1ccc2OCOc2c1 |
Structure |
|