| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein 5 |
|---|
| Ligand | BDBM50538230 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1972441 (CHEMBL4605259) |
|---|
| Ki | 1200±n/a nM |
|---|
| Citation |  Su, H; Zou, Y; Chen, G; Dou, H; Xie, H; Yuan, X; Zhang, X; Zhang, N; Li, M; Xu, Y Exploration of Fragment Binding Poses Leading to Efficient Discovery of Highly Potent and Orally Effective Inhibitors of FABP4 for Anti-inflammation. J Med Chem63:4090-4106 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein 5 |
|---|
| Name: | Fatty acid-binding protein 5 |
|---|
| Synonyms: | FABP5 | FABP5_HUMAN | Fatty acid binding protein epidermal | Fatty acid-binding protein 5 (FABP5) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 15164.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q01469 |
|---|
| Residue: | 135 |
|---|
| Sequence: | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
|
|
|
|---|
| BDBM50538230 |
|---|
| n/a |
|---|
| Name | BDBM50538230 |
|---|
| Synonyms: | CHEMBL4633440 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H17NO3 |
|---|
| Mol. Mass. | 319.3539 |
|---|
| SMILES | COc1cccc(Nc2ccccc2C(O)=O)c1-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
