Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Fatty acid-binding protein 5 |
---|
Ligand | BDBM50538237 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1972441 (CHEMBL4605259) |
---|
Ki | 32040±n/a nM |
---|
Citation | Su, H; Zou, Y; Chen, G; Dou, H; Xie, H; Yuan, X; Zhang, X; Zhang, N; Li, M; Xu, Y Exploration of Fragment Binding Poses Leading to Efficient Discovery of Highly Potent and Orally Effective Inhibitors of FABP4 for Anti-inflammation. J Med Chem63:4090-4106 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein 5 |
---|
Name: | Fatty acid-binding protein 5 |
Synonyms: | FABP5 | FABP5_HUMAN | Fatty acid binding protein epidermal | Fatty acid-binding protein 5 (FABP5) |
Type: | Enzyme |
Mol. Mass.: | 15164.79 |
Organism: | Homo sapiens (Human) |
Description: | Q01469 |
Residue: | 135 |
Sequence: | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
|
|
|
BDBM50538237 |
---|
n/a |
---|
Name | BDBM50538237 |
Synonyms: | CHEMBL4638396 |
Type | Small organic molecule |
Emp. Form. | C22H19ClN2O3 |
Mol. Mass. | 394.851 |
SMILES | CNc1ccc(Nc2ccccc2C(O)=O)c(c1Cl)-c1ccc2OCCc2c1 |
Structure |
|