Reaction Details |
| Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM21398 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1977671 (CHEMBL4610806) |
---|
Ki | 78±n/a nM |
---|
Citation | Baumeister, S; Schepmann, D; Wünsch, B Thiophene bioisosteres of GluN2B selective NMDA receptor antagonists: Synthesis and pharmacological evaluation of [7]annuleno[b]thiophen-6-amines. Bioorg Med Chem28:0 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20953.88 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q5U3Y7 |
Residue: | 176 |
Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
BDBM21398 |
---|
n/a |
---|
Name | BDBM21398 |
Synonyms: | 4-[4-(4-Chloro-phenyl)-4-hydroxy-piperidin-1-yl]-1-(4-fluoro-phenyl)-butan-1-one;propionate(HCl) | 4-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one | CHEMBL54 | CHEMBL545608 | Haloperidol | Haloperidol, 1 |
Type | Small organic molecule |
Emp. Form. | C21H23ClFNO2 |
Mol. Mass. | 375.864 |
SMILES | OC1(CCN(CCCC(=O)c2ccc(F)cc2)CC1)c1ccc(Cl)cc1 |
Structure |
|