Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM50539780 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1979320 (CHEMBL4612455) |
---|
IC50 | 2600±n/a nM |
---|
Citation | Chini, MG; Giordano, A; Potenza, M; Terracciano, S; Fischer, K; Vaccaro, MC; Colarusso, E; Bruno, I; Riccio, R; Koeberle, A; Werz, O; Bifulco, G Targeting mPGES-1 by a Combinatorial Approach: Identification of the Aminobenzothiazole Scaffold to Suppress PGE ACS Med Chem Lett11:783-789 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM50539780 |
---|
n/a |
---|
Name | BDBM50539780 |
Synonyms: | CHEMBL4643829 |
Type | Small organic molecule |
Emp. Form. | C21H18N2O3S |
Mol. Mass. | 378.444 |
SMILES | Cc1cc(C)c(o1)C(=O)Nc1nc2ccc(cc2s1)-c1cccc(CO)c1 |
Structure |
|