Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50540593 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1982303 (CHEMBL4615565) |
---|
Ki | 35±n/a nM |
---|
Citation | Zampieri, D; Fortuna, S; Calabretti, A; Romano, M; Menegazzi, R; Schepmann, D; Wünsch, B; Mamolo, MG Synthesis, Cytotoxicity Evaluation, and Computational Insights of Novel 1,4-Diazepane-Based Sigma Ligands. ACS Med Chem Lett11:651-656 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20953.88 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q5U3Y7 |
Residue: | 176 |
Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
BDBM50540593 |
---|
n/a |
---|
Name | BDBM50540593 |
Synonyms: | CHEMBL4640137 |
Type | Small organic molecule |
Emp. Form. | C24H27N3O |
Mol. Mass. | 373.4907 |
SMILES | Cc1ccc(CN2CCCN(CC2)C(=O)c2ccc3ccccc3n2)c(C)c1 |
Structure |
|