Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50540773 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1982771 (CHEMBL4616033) |
---|
Ki | 250±n/a nM |
---|
Citation | Amata, E; Dichiara, M; Gentile, D; Marrazzo, A; Turnaturi, R; Arena, E; La Mantia, A; Tomasello, BR; Acquaviva, R; Di Giacomo, C; Rescifina, A; Prezzavento, O Sigma Receptor Ligands Carrying a Nitric Oxide Donor Nitrate Moiety: Synthesis, In Silico, and Biological Evaluation. ACS Med Chem Lett11:889-894 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50540773 |
---|
n/a |
---|
Name | BDBM50540773 |
Synonyms: | CHEMBL4636822 |
Type | Small organic molecule |
Emp. Form. | C24H31N3O4 |
Mol. Mass. | 425.5206 |
SMILES | [O-][N+](=O)OCc1ccc(cc1)C(=O)NCCCCN1CCC(Cc2ccccc2)CC1 |
Structure |
|