Reaction Details |
| Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM197303 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1982772 (CHEMBL4616034) |
---|
Ki | >10000±n/a nM |
---|
Citation | Amata, E; Dichiara, M; Gentile, D; Marrazzo, A; Turnaturi, R; Arena, E; La Mantia, A; Tomasello, BR; Acquaviva, R; Di Giacomo, C; Rescifina, A; Prezzavento, O Sigma Receptor Ligands Carrying a Nitric Oxide Donor Nitrate Moiety: Synthesis, In Silico, and Biological Evaluation. ACS Med Chem Lett11:889-894 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | MAC30 | Meningioma-associated protein 30 | S2R | SGMR2_HUMAN | Sigma-2 receptor | Sigma2 receptor | TMEM97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20857.20 |
Organism: | Homo sapiens (Human) |
Description: | Q5BJF2 |
Residue: | 176 |
Sequence: | MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
|
|
|
BDBM197303 |
---|
n/a |
---|
Name | BDBM197303 |
Synonyms: | 4-Methylbenzoic acid | SAMPL4, O2 |
Type | Small organic molecule |
Emp. Form. | C8H8O2 |
Mol. Mass. | 136.1479 |
SMILES | Cc1ccc(cc1)C(O)=O |
Structure |
|