| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50545482 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1995376 (CHEMBL4629271) |
|---|
| Ki | 4.2±n/a nM |
|---|
| Citation |  Fujii, H; Uchida, Y; Shibasaki, M; Nishida, M; Yoshioka, T; Kobayashi, R; Honjo, A; Itoh, K; Yamada, D; Hirayama, S; Saitoh, A Discovery of ? opioid receptor full agonists lacking a basic nitrogen atom and their antidepressant-like effects. Bioorg Med Chem Lett30:0 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50545482 |
|---|
| n/a |
|---|
| Name | BDBM50545482 |
|---|
| Synonyms: | CHEMBL4649733 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H30N2O3 |
|---|
| Mol. Mass. | 490.5922 |
|---|
| SMILES | [H][C@]12Cc3ccc(O)cc3[C@@]3(CCN1C(=O)CCc1ccccc1)Cc1nc4ccccc4cc1C[C@@]23O |r,THB:14:13:9.3.2:36| |
|---|
| Structure | 
|
|---|
Search and Browse
