Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50545792 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1996597 (CHEMBL4630492) |
---|
Ki | 0.074000±n/a nM |
---|
Citation | Rusere, LN; Lockbaum, GJ; Henes, M; Lee, SK; Spielvogel, E; Rao, DN; Kosovrasti, K; Nalivaika, EA; Swanstrom, R; Kurt Yilmaz, N; Schiffer, CA; Ali, A Structural Analysis of Potent Hybrid HIV-1 Protease Inhibitors Containing Bis-tetrahydrofuran in a Pseudosymmetric Dipeptide Isostere. J Med Chem63:8296-8313 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50545792 |
---|
n/a |
---|
Name | BDBM50545792 |
Synonyms: | CHEMBL4639819 |
Type | Small organic molecule |
Emp. Form. | C32H43N3O8 |
Mol. Mass. | 597.6991 |
SMILES | [H][C@@]12CCO[C@]1([H])OC[C@@H]2OC(=O)N[C@H](C[C@H](O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)OC)C(C)C)Cc1ccccc1 |r| |
Structure |
|