Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50548580 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2022613 (CHEMBL4676426) |
---|
Ki | 142±n/a nM |
---|
Citation | García, M; Virgili, M; Alonso, M; Alegret, C; Farran, J; Fernández, B; Bordas, M; Pascual, R; Burgueño, J; Vidal-Torres, A; Fernández de Henestrosa, AR; Ayet, E; Merlos, M; Vela, JM; Plata-Salamán, CR; Almansa, C Discovery of EST73502, a Dual ?-Opioid Receptor Agonist and ? J Med Chem63:15508-15526 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50548580 |
---|
n/a |
---|
Name | BDBM50548580 |
Synonyms: | CHEMBL4786209 |
Type | Small organic molecule |
Emp. Form. | C18H26N2O2 |
Mol. Mass. | 302.4112 |
SMILES | CC1OC2(CCN(CCc3ccccc3)CC2)CN(C)C1=O |
Structure |
|