Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Genome polyprotein |
---|
Ligand | BDBM50111457 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_158809 (CHEMBL765657) |
---|
EC50 | 1410±n/a nM |
---|
Citation | Dragovich, PS; Prins, TJ; Zhou, R; Brown, EL; Maldonado, FC; Fuhrman, SA; Zalman, LS; Tuntland, T; Lee, CA; Patick, AK; Matthews, DA; Hendrickson, TF; Kosa, MB; Liu, B; Batugo, MR; Gleeson, JP; Sakata, SK; Chen, L; Guzman, MC; Meador, JW; Ferre, RA; Worland, ST Structure-based design, synthesis, and biological evaluation of irreversible human rhinovirus 3C protease inhibitors. 6. Structure-activity studies of orally bioavailable, 2-pyridone-containing peptidomimetics. J Med Chem45:1607-23 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Genome polyprotein |
---|
Name: | Genome polyprotein |
Synonyms: | Human rhinovirus A protease | Human rhinovirus B 3A protease |
Type: | PROTEIN |
Mol. Mass.: | 44361.04 |
Organism: | Human rhinovirus B |
Description: | ChEMBL_158953 |
Residue: | 401 |
Sequence: | AFRPCNVNTKIGNAKCCPFVCGKAVTFKDRSTCSTYNLSSSLHHILEEDKRRRQVVDVMS
AIFQGPISLDAPPPPAIADLLQSVRTPRVIKYCQIIMGHPAECQVERDLNIANSIIAIIA
NIISIAGIIFVIYKLFCSLQGPYSGEPKPKTKVPERRVVAQGPEEEFGRSILKNNTCVIT
TGNGKFTGLGIHDRILIIPTHADPGREVQVNGVHTKVLDSYDLYNRDGVKLEITVIQLDR
NEKFRDIRKYIPETEDDYPECNLALSANQDEPTIIKVGDVVSYGNILLSGNQTARMLKYN
YPTKSGYCGGVLYKIGQILGIHVGGNGRDGFSAMLLRSYFTGQIKVNKHATECGLPDIQT
IHTPSKTKLQPSVFYDVFPGSKEPAVLTDNDPRLEVNFKEA
|
|
|
BDBM50111457 |
---|
n/a |
---|
Name | BDBM50111457 |
Synonyms: | 6-Carbamoyl-4-(2-{3-[([1,3]dithiolane-2-carbonyl)-amino]-2-oxo-2H-pyridin-1-yl}-3-phenyl-propionylamino)-hex-2-enoic acid ethyl ester | CHEMBL43385 | trans-(2S,4'S)-6-Carbamoyl-4-(2'-{3''-[([1''',3''']dithiolane-2'''-carbonyl)amino-2''-oxo-2''H-pyridin-1''-yl}-3'-phenylpropionylamino)hex-2-enoic Acid Ethyl Ester |
Type | Small organic molecule |
Emp. Form. | C27H32N4O6S2 |
Mol. Mass. | 572.696 |
SMILES | CCOC(=O)\C=C\[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccccc1)n1cccc(NC(=O)C2SCCS2)c1=O |r| |
Structure |
|