| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alpha-synuclein |
|---|
| Ligand | BDBM17289 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2045851 (CHEMBL4700550) |
|---|
| IC50 | 93100±n/a nM |
|---|
| Citation |  Oliveri, V Toward the discovery and development of effective modulators of ?-synuclein amyloid aggregation. Eur J Med Chem167:10-36 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Alpha-synuclein |
|---|
| Name: | Alpha-synuclein |
|---|
| Synonyms: | NACP | PARK1 | SNCA | SYUA_HUMAN |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14451.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P37840 |
|---|
| Residue: | 140 |
|---|
| Sequence: | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
|
|
|
|---|
| BDBM17289 |
|---|
| n/a |
|---|
| Name | BDBM17289 |
|---|
| Synonyms: | (1S,10R,11S,15S)-5-hydroxy-15-methyltetracyclo[8.7.0.0^{2,7}.0^{11,15}]heptadeca-2,4,6-trien-14-one | CHEMBL1405 | Estrone | Estrone (E1) | Estrone, 15 | Estrovarin | Kestrone | Theelin | Unigen | [2,4,6,7-3H]-E1 | [2,4,6,7-3H]-Estrone | folliculin |
|---|
| Type | Steroid |
|---|
| Emp. Form. | C18H22O2 |
|---|
| Mol. Mass. | 270.3661 |
|---|
| SMILES | [H][C@@]12CCC(=O)[C@@]1(C)CC[C@]1([H])c3ccc(O)cc3CC[C@@]21[H] |
|---|
| Structure | 
|
|---|
Search and Browse
