| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alpha-synuclein |
|---|
| Ligand | BDBM50133496 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2045853 (CHEMBL4700552) |
|---|
| IC50 | 210±n/a nM |
|---|
| Citation |  Oliveri, V Toward the discovery and development of effective modulators of ?-synuclein amyloid aggregation. Eur J Med Chem167:10-36 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Alpha-synuclein |
|---|
| Name: | Alpha-synuclein |
|---|
| Synonyms: | NACP | PARK1 | SNCA | SYUA_HUMAN |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14451.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P37840 |
|---|
| Residue: | 140 |
|---|
| Sequence: | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
|
|
|
|---|
| BDBM50133496 |
|---|
| n/a |
|---|
| Name | BDBM50133496 |
|---|
| Synonyms: | (2R)-3-(3,4-dihydroxyphenyl)-2-[(2E)-3-(3,4-dihydroxyphenyl)prop-2-enoyloxy]propanoic acid | (R)-rosmarinic acid | CHEMBL324842 | Rosmarinic acid, 2 | US10688093, Compound rosmarinic acid | US11701353, rosmarinic acid | cid_5281792 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H16O8 |
|---|
| Mol. Mass. | 360.3148 |
|---|
| SMILES | OC(=O)[C@@H](Cc1ccc(O)c(O)c1)OC(=O)\C=C\c1ccc(O)c(O)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
