Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Macrophage migration inhibitory factor |
---|
Ligand | BDBM50553879 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2047513 (CHEMBL4702212) |
---|
IC50 | 19100±n/a nM |
---|
Citation | Xiao, Z; Chen, D; Song, S; van der Vlag, R; van der Wouden, PE; van Merkerk, R; Cool, RH; Hirsch, AKH; Melgert, BN; Quax, WJ; Poelarends, GJ; Dekker, FJ 7-Hydroxycoumarins Are Affinity-Based Fluorescent Probes for Competitive Binding Studies of Macrophage Migration Inhibitory Factor. J Med Chem63:11920-11933 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Macrophage migration inhibitory factor |
---|
Name: | Macrophage migration inhibitory factor |
Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
Type: | Enzyme |
Mol. Mass.: | 12478.18 |
Organism: | Homo sapiens (Human) |
Description: | P14174 |
Residue: | 115 |
Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
BDBM50553879 |
---|
n/a |
---|
Name | BDBM50553879 |
Synonyms: | CHEMBL4776234 |
Type | Small organic molecule |
Emp. Form. | C15H9ClO3 |
Mol. Mass. | 272.683 |
SMILES | Oc1ccc2cc(-c3ccccc3Cl)c(=O)oc2c1 |
Structure |
|