Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1A |
---|
Ligand | BDBM21393 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2063306 (CHEMBL4718559) |
---|
Ki | 9.4±n/a nM |
---|
Citation | Stefanowicz, J; S?owi?ski, T; Wróbel, MZ; Herold, F; Gomó?ka, AE; Weso?owska, A; Jastrz?bska-Wi?sek, M; Partyka, A; Andres-Mach, M; Czuczwar, SJ; ?uszczki, JJ; Zagaja, M; Siwek, A; Nowak, G; ?o?nierek, M; B?czek, T; Ulenberg, S; Belka, M; Tur?o, J Synthesis and biological investigation of new equatorial (?) stereoisomers of 3-aminotropane arylamides with atypical antipsychotic profile. Bioorg Med Chem24:3994-4007 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 1A |
---|
Name: | 5-hydroxytryptamine receptor 1A |
Synonyms: | 5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A (5HT1A) | 5HT1A_RAT | 5ht1a | G-21 | Htr1a | Serotonin 1 (5-HT1) receptor | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 46445.29 |
Organism: | Rattus norvegicus (rat) |
Description: | Binding assays were performed using rat hippocampal membranes. |
Residue: | 422 |
Sequence: | MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
|
|
|
BDBM21393 |
---|
n/a |
---|
Name | BDBM21393 |
Synonyms: | 7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-1-ol | 8-Hydroxy-2-(di-n-propylamino)tetralin | 8-OH-DPAT | 8-OH-DPAT,(+) | 8-OH-DPAT,(-) | 8-hydroxy-N,N-dipropylaminotetralin | CHEMBL1788118 | CHEMBL505765 | CHEMBL56 | DPAT | US10562853, Compound 8-OH-DPAT | [3H]-8-OH-DPAT | cid_1220 |
Type | radiolabeled ligand |
Emp. Form. | C16H25NO |
Mol. Mass. | 247.3758 |
SMILES | CCCN(CCC)C1CCc2cccc(O)c2C1 |
Structure |
|