Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50562058 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2076986 (CHEMBL4732777) |
---|
Ki | 12100±n/a nM |
---|
Citation | Deuther-Conrad, W; Diez-Iriepa, D; Iriepa, I; López-Muñoz, F; Martínez-Grau, MA; Gütschow, M; Marco-Contelles, J Studies on the affinity of 6-[( RSC Med Chem12:1000-1004 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50562058 |
---|
n/a |
---|
Name | BDBM50562058 |
Synonyms: | CHEMBL4794757 |
Type | Small organic molecule |
Emp. Form. | C15H19NO3 |
Mol. Mass. | 261.3163 |
SMILES | CCN(CC)CCOc1ccc2occc(=O)c2c1 |
Structure |
|