| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50562057 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2076987 (CHEMBL4732778) |
|---|
| Ki | 4100±n/a nM |
|---|
| Citation |  Deuther-Conrad, W; Diez-Iriepa, D; Iriepa, I; López-Muñoz, F; Martínez-Grau, MA; Gütschow, M; Marco-Contelles, J Studies on the affinity of 6-[( RSC Med Chem12:1000-1004 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20953.88 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q5U3Y7 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
|---|
| BDBM50562057 |
|---|
| n/a |
|---|
| Name | BDBM50562057 |
|---|
| Synonyms: | CHEMBL4751000 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H26N2O3 |
|---|
| Mol. Mass. | 330.4213 |
|---|
| SMILES | CN1CCN(CCCCCOc2ccc3occc(=O)c3c2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
