Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Cannabinoid receptor 2 |
---|
Ligand | BDBM50562159 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2077575 (CHEMBL4733366) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Granchi, C; Bononi, G; Ferrisi, R; Gori, E; Mantini, G; Glasmacher, S; Poli, G; Palazzolo, S; Caligiuri, I; Rizzolio, F; Canzonieri, V; Perin, T; Gertsch, J; Sodi, A; Giovannetti, E; Macchia, M; Minutolo, F; Tuccinardi, T; Chicca, A Design, synthesis and biological evaluation of second-generation benzoylpiperidine derivatives as reversible monoacylglycerol lipase (MAGL) inhibitors. Eur J Med Chem209:0 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cannabinoid receptor 2 |
---|
Name: | Cannabinoid receptor 2 |
Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 39690.94 |
Organism: | Homo sapiens (Human) |
Description: | P34972 |
Residue: | 360 |
Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
BDBM50562159 |
---|
n/a |
---|
Name | BDBM50562159 |
Synonyms: | CHEMBL4798508 |
Type | Small organic molecule |
Emp. Form. | C26H24FNO3 |
Mol. Mass. | 417.4721 |
SMILES | Oc1ccc(F)c(c1)C(=O)N1CCC(CC1)C(=O)c1ccc(Cc2ccccc2)cc1 |
Structure |
|