Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | N-formyl peptide receptor 2 |
---|
Ligand | BDBM50563098 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2081563 (CHEMBL4737354) |
---|
EC50 | 730±n/a nM |
---|
Citation | Maciuszek, M; Ortega-Gomez, A; Maas, SL; Perretti, M; Merritt, A; Soehnlein, O; Chapman, TM Synthesis and evaluation of novel cyclopentane urea FPR2 agonists and their potential application in the treatment of cardiovascular inflammation. Eur J Med Chem214:0 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
N-formyl peptide receptor 2 |
---|
Name: | N-formyl peptide receptor 2 |
Synonyms: | ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | FPR2 | FPR2_HUMAN | FPRH1 | FPRL1 | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | LXA4R | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38968.35 |
Organism: | Homo sapiens (Human) |
Description: | P25090 |
Residue: | 351 |
Sequence: | METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
|
|
|
BDBM50563098 |
---|
n/a |
---|
Name | BDBM50563098 |
Synonyms: | CHEMBL4762222 |
Type | Small organic molecule |
Emp. Form. | C14H13BrN4O2 |
Mol. Mass. | 349.183 |
SMILES | Brc1ccc(NC(=O)NCC(=O)Nc2cccnc2)cc1 |
Structure |
|