| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein ADM2 |
|---|
| Ligand | BDBM50570386 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2112107 (CHEMBL4820957) |
|---|
| IC50 | 1259±n/a nM |
|---|
| Citation |  Zirimwabagabo, JO; Jailani, ABA; Avgoustou, P; Tozer, MJ; Gibson, KR; Glossop, PA; Mills, JEJ; Porter, RA; Blaney, P; Wang, N; Skerry, TM; Richards, GO; Harrity, JPA Discovery of a First-In-Class Small Molecule Antagonist against the Adrenomedullin-2 Receptor: Structure-Activity Relationships and Optimization. J Med Chem64:3299-3319 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein ADM2 |
|---|
| Name: | Protein ADM2 |
|---|
| Synonyms: | ADM2 | ADM2_HUMAN | AM2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15883.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_556927 |
|---|
| Residue: | 148 |
|---|
| Sequence: | MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVW
KLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNL
SHRLWQLMGPAGRQDSAPVDPSSPHSYG
|
|
|
|---|
| BDBM50570386 |
|---|
| n/a |
|---|
| Name | BDBM50570386 |
|---|
| Synonyms: | CHEMBL4864804 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H30N4O4 |
|---|
| Mol. Mass. | 462.5408 |
|---|
| SMILES | CN1C(=O)NC(=O)C11Cc2ccc(NC(=O)CN(Cc3ccccc3)C(=O)C(C)(C)C)cc2C1 |
|---|
| Structure | 
|
|---|
Search and Browse
