Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Interleukin-15 |
---|
Ligand | BDBM50571054 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2113695 (CHEMBL4822545) |
---|
IC50 | 23500±n/a nM |
---|
Citation | Smadja, J; Quéméner, A; Maillasson, M; Sicard, B; Leray, A; Arzel, L; Lebreton, J; Mortier, E; Dubreuil, D; Mathé-Allainmat, M Rational modification, synthesis and biological evaluation of N-substituted phthalazinone derivatives designed to target interleukine-15 protein. Bioorg Med Chem39:0 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Interleukin-15 |
---|
Name: | Interleukin-15 |
Synonyms: | IL-15 | IL15_MOUSE | Il15 | Interleukin-15 |
Type: | PROTEIN |
Mol. Mass.: | 18588.73 |
Organism: | Mus musculus |
Description: | ChEMBL_120403 |
Residue: | 162 |
Sequence: | MKILKPYMRNTSISCYLCFLLNSHFLTEAGIHVFILGCVSVGLPKTEANWIDVRYDLEKI
ESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANS
TLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
|
|
|
BDBM50571054 |
---|
n/a |
---|
Name | BDBM50571054 |
Synonyms: | CHEMBL4864898 |
Type | Small organic molecule |
Emp. Form. | C29H32Cl2N6O4S |
Mol. Mass. | 631.573 |
SMILES | Cn1nc(Cc2nnc(SCCCCCCCC(=O)Nc3ccc(Cl)cc3Cl)n2CCC(O)=O)c2ccccc2c1=O |
Structure |
|