Reaction Details |
| Report a problem with these data |
Target | Interleukin-15 |
---|
Ligand | BDBM50571061 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2113697 (CHEMBL4822547) |
---|
IC50 | 20000±n/a nM |
---|
Citation | Smadja, J; Quéméner, A; Maillasson, M; Sicard, B; Leray, A; Arzel, L; Lebreton, J; Mortier, E; Dubreuil, D; Mathé-Allainmat, M Rational modification, synthesis and biological evaluation of N-substituted phthalazinone derivatives designed to target interleukine-15 protein. Bioorg Med Chem39:0 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Interleukin-15 |
---|
Name: | Interleukin-15 |
Synonyms: | IL-15 | IL15 | IL15-IL15 receptor | IL15_HUMAN | Interleukin-15 |
Type: | PROTEIN |
Mol. Mass.: | 18080.13 |
Organism: | Homo sapiens |
Description: | ChEMBL_117698 |
Residue: | 162 |
Sequence: | MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKI
EDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANN
SLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
|
|
|
BDBM50571061 |
---|
n/a |
---|
Name | BDBM50571061 |
Synonyms: | CHEMBL4861648 |
Type | Small organic molecule |
Emp. Form. | C26H28Cl2N6O2S |
Mol. Mass. | 559.511 |
SMILES | Cn1c(Cc2n[nH]c(=O)c3ccccc23)nnc1SCCCCCCCC(=O)Nc1ccc(Cl)cc1Cl |
Structure |
|