Reaction Details |
| Report a problem with these data |
Target | Calcium and integrin-binding protein 1 |
---|
Ligand | BDBM50572333 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2116701 (CHEMBL4825642) |
---|
IC50 | 67±n/a nM |
---|
Citation | Haberman, VA; Fleming, SR; Leisner, TM; Puhl, AC; Feng, E; Xie, L; Chen, X; Goto, Y; Suga, H; Parise, LV; Kireev, D; Pearce, KH; Bowers, AA Discovery and Development of Cyclic Peptide Inhibitors of CIB1. ACS Med Chem Lett12:1832-1839 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Calcium and integrin-binding protein 1 |
---|
Name: | Calcium and integrin-binding protein 1 |
Synonyms: | CIB | CIB1 | CIB1_HUMAN | Calcium and integrin-binding protein 1 | Calcium- and integrin-binding protein | Calmyrin | KIP | PRKDCIP |
Type: | PROTEIN |
Mol. Mass.: | 21691.54 |
Organism: | Homo sapiens |
Description: | ChEMBL_120467 |
Residue: | 191 |
Sequence: | MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILS
LPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDD
GTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS
PDFASSFKIVL
|
|
|
BDBM50572333 |
---|
n/a |
---|
Name | BDBM50572333 |
Synonyms: | CHEMBL4871134 |
Type | Small organic molecule |
Emp. Form. | C77H101N15O15S |
Mol. Mass. | 1508.782 |
SMILES | CC[C@H](C)[C@@H]1NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccc(O)cc2)N(C)C(=O)[C@@H]2CCCN2C(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](Cc2ccc(O)cc2)NC(=O)CSC[C@H](NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](CC(C)C)NC1=O)C(N)=O |r| |
Structure |
|