Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50135800 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_147025 (CHEMBL753666) |
---|
Ki | 1.9±n/a nM |
---|
Citation | Zhang, A; Xiong, W; Bidlack, JM; Hilbert, JE; Knapp, BI; Wentland, MP; Neumeyer, JL 10-Ketomorphinan and 3-substituted-3-desoxymorphinan analogues as mixed kappa and micro opioid ligands: synthesis and biological evaluation of their binding affinity at opioid receptors. J Med Chem47:165-74 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50135800 |
---|
n/a |
---|
Name | BDBM50135800 |
Synonyms: | (-)-3-Hydroxy-N-cycloproypylmethylmorphinan Mandelate | 17-cyclopropylmethyl-(1R,9R,10R)-17-azatetracyclo[7.5.3.01,10.02,7]heptadeca-2(7),3,5-trien-4-ol | 3-Hydroxy-N-cyclopropylmethylmorphinan | CHEMBL49269 | CYCLORPHAN | US10231963, Table B.6 | US10736890, Compound TABLE B.6 | US11534436, Compound Table B.6 | US9656961, Example 00123 |
Type | Small organic molecule |
Emp. Form. | C20H27NO |
Mol. Mass. | 297.4345 |
SMILES | Oc1ccc2C[C@@H]3[C@@H]4CCCC[C@]4(CCN3CC3CC3)c2c1 |
Structure |
|